Audit log
Substrate-level change journal. Every verb-driven insert / update / delete writes here with the originating agent, the verb that caused it, the changed field set, and the model that ran the action. The source of truth for "what happened and who did it."
insert protein_designs protein_design-9e02ec768877 1h ago before / after
{ "title": "Engineered LRRK2 kinase-domain inhibitor scaffold", "content": { "fold": "alpha-beta", "domain": "parkinsons", "method": "rosetta", "summary": "Scaffolded peptide inhibitor of LRRK2 kinase activity; competes with ATP-binding site, type-1 inhibitor mode.", "metadata": {}, "sequence": "MASGSCQGCEEDEETLKKLIVRLNNVQEGKQIETLVQILEDLLVFTFEK", "target_id": "Q5S007", "target_family": "kinase", "af2_confidence": 84.7, "target_function": "binder" }, "content_hash": "sha256:96574768cc9ebc93b4d0cf4cb0a1ec356c88a5169ff555fadb6af4f970a35402" }insert protein_designs protein_design-0a6cd446b4fb 1h ago before / after
{ "title": "Huntingtin polyQ-tract recognizer", "content": { "fold": "alpha", "domain": "huntingtons", "method": "esm-fold", "summary": "Binder selective for polyQ tracts >35 repeats; targets mutant HTT for selective degradation via PROTAC linker.", "metadata": {}, "sequence": "MQQQQQQQQQQQQQQQRYRELGFCGSFNCRSKRKLFCANCGNRH", "target_id": "P42858", "target_family": "polyQ", "af2_confidence": 75.2, "target_function": "binder" }, "content_hash": "sha256:b5bb289b36fc09ca721b90d99792c6364c8bf50a866f111a62906c80ac532162" }insert protein_designs protein_design-9f3c2405114b 1h ago before / after
{ "title": "TDP-43 N-terminal stabilizer", "content": { "fold": "mixed", "domain": "als", "method": "proteinmpnn", "summary": "Stabilizer for the TDP-43 N-terminal dimerization interface; rescues nuclear localization in iPSC-MN model.", "metadata": {}, "sequence": "MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRY", "target_id": "Q13148", "target_family": "RNA-binding", "af2_confidence": 78.6, "target_function": "binder" }, "content_hash": "sha256:bf3a28f26bb969cad59c7dbe49978b05684caf5415ffa3f8db32aaa839332dca" }insert protein_designs protein_design-5e95b60d724c 1h ago before / after
{ "title": "α-Synuclein aggregation inhibitor", "content": { "fold": "beta", "domain": "parkinsons", "method": "rfdiffusion", "summary": "Designed mini-binder against the α-synuclein NAC region; reduces in vitro aggregation kinetics 4-fold.", "metadata": {}, "sequence": "MKVISGEYALYAAEEPNTAVHQDIPDLRKQGAEVYITPLQQVRDLAKEY", "target_id": "P37840", "target_family": "amyloid", "af2_confidence": 82.1, "target_function": "binder" }, "content_hash": "sha256:144237c4b84909e7ded1102ea73094426d64a724bc4a82f7ab774a60951e1385" }insert protein_designs protein_design-2177c6a5295b 1h ago before / after
{ "title": "Anti-Aβ42 binder de novo", "content": { "fold": "alpha", "domain": "alzheimers", "method": "rfdiffusion", "summary": "De novo binder targeting the Aβ42 protofibril N-terminus; designed via RFdiffusion + ProteinMPNN, validated by AF2 confidence.", "metadata": {}, "sequence": "MKVITLAFGTAVAGAGFAAQVPTVAFTPADQQAVDDFVQKVASLSEKQYE", "target_id": "P05067", "target_family": "amyloid", "af2_confidence": 87.4, "target_function": "binder" }, "content_hash": "sha256:c14be017e8687ac9b1a728b85efd8a3c5fabbd1538df17c689a6d8ba6e3bbd72" }insert dataset ds-532d8b1a7781 1h ago before / after
{ "title": "ROSMAP — Religious Orders Study and Memory and Aging", "content": { "domain": "alzheimers", "n_rows": 3500, "license": "CC-BY-NC-4.0", "summary": "Two longitudinal cohorts of older adults with annual cognitive testing, brain donation, RNA-seq, proteomics, methylation, and detailed neuropath assessment.", "version": "v2024", "file_format": "csv", "download_url": "https://www.synapse.org/#!Synapse:syn3219045", "landing_page": "https://www.radc.rush.edu/" }, "content_hash": "sha256:0217583a7366c1601fc53a255e13658fa14db8a245c6bd6a1179b2f2bf1ac61d" }insert dataset ds-e6f331052fc4 1h ago before / after
{ "title": "Tabula Sapiens — Human Single-Cell Atlas", "content": { "domain": "neuroscience", "n_rows": 1100000, "license": "CC-BY-4.0", "summary": "Cross-tissue single-cell transcriptomic atlas of healthy human donors — 1.1M cells, 24 organs, used as reference for cell-type deconvolution.", "version": "v2", "file_format": "h5ad", "download_url": "https://tabula-sapiens-portal.ds.czbiohub.org/", "landing_page": "https://tabula-sapiens-portal.ds.czbiohub.org/" }, "content_hash": "sha256:92073ae69617b6b303c6da7e5102ea2b2d4963c9336e9189b862351ddc364668" }insert dataset ds-c7bd27cb7ae8 1h ago before / after
{ "title": "DepMap 24Q4 — Cancer Cell Line Dependency Map", "content": { "domain": "neurodegeneration", "n_rows": 1100, "license": "CC-BY-4.0", "summary": "Genome-wide CRISPR knockouts (Chronos) across 1,100+ cancer cell lines plus drug sensitivity panels — foundational resource for target validation.", "version": "24Q4", "file_format": "csv", "download_url": "https://depmap.org/portal/data_page/", "landing_page": "https://depmap.org/" }, "content_hash": "sha256:bfd1426d8b74ae817ae6d48f1d2a6e5783a70653f9505b6772ae3d740afb5197" }insert dataset ds-0c4430e71b3c 1h ago before / after
{ "title": "Allen Brain Atlas — Mouse Adult Brain ISH", "content": { "domain": "neuroscience", "n_rows": 26000, "license": "CC-BY-4.0", "summary": "In situ hybridization expression-energy maps for ~20K genes across mouse adult brain regions — the canonical brain-region-specific expression reference.", "version": "v2", "file_format": "csv", "download_url": "https://mouse.brain-map.org/", "landing_page": "https://atlas.brain-map.org/" }, "content_hash": "sha256:4b0c781d45c5cdc49dfbe44ba13d5f422b8b1521d8f745cf235b8c7ed213893d" }insert dataset ds-479bb0c90d41 1h ago before / after
{ "title": "GTEx v10 — Genotype-Tissue Expression", "content": { "domain": "neuroscience", "n_rows": 17382, "license": "CC-BY-4.0", "summary": "Bulk RNA-seq across 54 human tissues including 13 brain regions; eQTL maps used to instrument MR analyses.", "version": "v10", "file_format": "h5ad", "download_url": "https://gtexportal.org/home/downloads/adult-gtex/bulk_tissue_expression", "landing_page": "https://gtexportal.org/" }, "content_hash": "sha256:127b02d9e884390f38b7f9457704a2b18540316ae7d343f6ccd0226bf74af9a2" }insert dataset ds-59340d8fc4c1 1h ago before / after
{ "title": "DIAN — Dominantly Inherited Alzheimer Network", "content": { "domain": "alzheimers", "n_rows": 600, "license": "CC-BY-NC-4.0", "summary": "Autosomal-dominant AD families with longitudinal CSF, plasma, MRI, PET, and cognitive trajectories from pre-symptomatic through dementia stages.", "version": "v2024", "file_format": "csv", "download_url": "https://dian.wustl.edu/", "landing_page": "https://dian.wustl.edu/" }, "content_hash": "sha256:9876e82f334da885373a35ac3b5c759825554952ee51da49e2c1e4e75ad65317" }insert dataset ds-e1f8489220a7 1h ago before / after
{ "title": "UK Biobank — Population Cohort with Genomics + Imaging", "content": { "domain": "neurodegeneration", "n_rows": 500000, "license": "CC-BY-NC-4.0", "summary": "500K participants with genome-wide genotyping, neuroimaging (~50K), biofluid biomarkers, and longitudinal clinical outcomes — primary cohort for late-onset disease genetics.", "version": "v2024", "file_format": "parquet", "download_url": "https://www.ukbiobank.ac.uk/enable-your-research/apply-for-access", "landing_page": "https://www.ukbiobank.ac.uk/" }, "content_hash": "sha256:4fd152f8353501e6a919a34662e416e5425fb1b99f3c96f5360ed6214e472ed6" }insert dataset ds-53a21bb8d46c 1h ago before / after
{ "title": "Answer ALS — Multi-omic Profiling of ALS Patients", "content": { "domain": "als", "n_rows": 1000, "license": "CC-BY-NC-4.0", "summary": "Multi-omic ALS patient profiling with iPSC-derived motor neurons, RNA-seq, ATAC-seq, proteomics, and clinical longitudinal data.", "version": "v2.0", "file_format": "h5ad", "download_url": "https://www.answerals.org/data", "landing_page": "https://www.answerals.org/" }, "content_hash": "sha256:18534d6fe2f57a2c1b6c9e626371f04c223ac303c9be6b50b6743bafc31484f4" }insert dataset ds-5ff4138ab32a 1h ago before / after
{ "title": "PPMI — Parkinson's Progression Markers Initiative", "content": { "domain": "parkinsons", "n_rows": 1500, "license": "CC-BY-4.0", "summary": "Longitudinal observational cohort of de novo Parkinson's patients with imaging, biofluids, genetics, clinical, and digital biomarkers.", "version": "v2024", "file_format": "csv", "download_url": "https://www.ppmi-info.org/access-data-specimens/download-data", "landing_page": "https://www.ppmi-info.org/" }, "content_hash": "sha256:35fadc17e86976c527ec8082a941b3bef5f3f12aa75b7fb842f5abad0f22f624" }insert dataset ds-09d0d0587fc3 1h ago before / after
{ "title": "ADNI — Alzheimer's Disease Neuroimaging Initiative", "content": { "domain": "alzheimers", "n_rows": 2400, "license": "CC-BY-4.0", "summary": "Longitudinal multisite study with structural MRI, PET, CSF, plasma biomarkers, cognitive evaluations across cognitively-normal, MCI, and AD subjects.", "version": "v3", "file_format": "csv", "download_url": "https://adni.loni.usc.edu/data-samples/access-data/", "landing_page": "https://adni.loni.usc.edu/" }, "content_hash": "sha256:8a2436e2a3198ee8d088646ba609e6cfc358cf22d6baf3525e96844eaad26285" }insert protein_designs protein_design-2d63a1db6efe 1h ago before / after
{ "title": "Test", "content": { "fold": "alpha", "method": "rfdiffusion", "metadata": {}, "sequence": "MKVITLAFGTAVAGAGFAAQVPTVAFTPADQQAVDDFVQKVASLSEKQYE", "target_function": "binder" }, "content_hash": "sha256:26f7493a9cad4c9b0b536526f2255b85e3b3cdd9635614ad3c8edfa8112b0016" }insert dataset ds-e68ab8617139 1h ago before / after
{ "title": "ROSMAP — Religious Orders Study and Memory and Aging", "content": { "domain": "alzheimers", "n_rows": 3500, "license": "CC-BY-NC-4.0", "summary": "Two longitudinal cohorts of older adults with annual cognitive testing, brain donation, RNA-seq, proteomics, methylation, and detailed neuropath assessment.", "version": "v2024", "file_format": "csv", "download_url": "https://www.synapse.org/#!Synapse:syn3219045", "landing_page": "https://www.radc.rush.edu/" }, "content_hash": "sha256:0217583a7366c1601fc53a255e13658fa14db8a245c6bd6a1179b2f2bf1ac61d" }insert dataset ds-4d31594adc89 1h ago before / after
{ "title": "Tabula Sapiens — Human Single-Cell Atlas", "content": { "domain": "neuroscience", "n_rows": 1100000, "license": "CC-BY-4.0", "summary": "Cross-tissue single-cell transcriptomic atlas of healthy human donors — 1.1M cells, 24 organs, used as reference for cell-type deconvolution.", "version": "v2", "file_format": "h5ad", "download_url": "https://tabula-sapiens-portal.ds.czbiohub.org/", "landing_page": "https://tabula-sapiens-portal.ds.czbiohub.org/" }, "content_hash": "sha256:92073ae69617b6b303c6da7e5102ea2b2d4963c9336e9189b862351ddc364668" }insert dataset ds-231abeccbbe1 1h ago before / after
{ "title": "DepMap 24Q4 — Cancer Cell Line Dependency Map", "content": { "domain": "neurodegeneration", "n_rows": 1100, "license": "CC-BY-4.0", "summary": "Genome-wide CRISPR knockouts (Chronos) across 1,100+ cancer cell lines plus drug sensitivity panels — foundational resource for target validation.", "version": "24Q4", "file_format": "csv", "download_url": "https://depmap.org/portal/data_page/", "landing_page": "https://depmap.org/" }, "content_hash": "sha256:bfd1426d8b74ae817ae6d48f1d2a6e5783a70653f9505b6772ae3d740afb5197" }insert dataset ds-2a6ea069078e 1h ago before / after
{ "title": "Allen Brain Atlas — Mouse Adult Brain ISH", "content": { "domain": "neuroscience", "n_rows": 26000, "license": "CC-BY-4.0", "summary": "In situ hybridization expression-energy maps for ~20K genes across mouse adult brain regions — the canonical brain-region-specific expression reference.", "version": "v2", "file_format": "csv", "download_url": "https://mouse.brain-map.org/", "landing_page": "https://atlas.brain-map.org/" }, "content_hash": "sha256:4b0c781d45c5cdc49dfbe44ba13d5f422b8b1521d8f745cf235b8c7ed213893d" }insert dataset ds-bea34c99c186 1h ago before / after
{ "title": "GTEx v10 — Genotype-Tissue Expression", "content": { "domain": "neuroscience", "n_rows": 17382, "license": "CC-BY-4.0", "summary": "Bulk RNA-seq across 54 human tissues including 13 brain regions; eQTL maps used to instrument MR analyses.", "version": "v10", "file_format": "h5ad", "download_url": "https://gtexportal.org/home/downloads/adult-gtex/bulk_tissue_expression", "landing_page": "https://gtexportal.org/" }, "content_hash": "sha256:127b02d9e884390f38b7f9457704a2b18540316ae7d343f6ccd0226bf74af9a2" }insert dataset ds-ba471f539287 1h ago before / after
{ "title": "DIAN — Dominantly Inherited Alzheimer Network", "content": { "domain": "alzheimers", "n_rows": 600, "license": "CC-BY-NC-4.0", "summary": "Autosomal-dominant AD families with longitudinal CSF, plasma, MRI, PET, and cognitive trajectories from pre-symptomatic through dementia stages.", "version": "v2024", "file_format": "csv", "download_url": "https://dian.wustl.edu/", "landing_page": "https://dian.wustl.edu/" }, "content_hash": "sha256:9876e82f334da885373a35ac3b5c759825554952ee51da49e2c1e4e75ad65317" }insert dataset ds-c92688f7513c 1h ago before / after
{ "title": "UK Biobank — Population Cohort with Genomics + Imaging", "content": { "domain": "neurodegeneration", "n_rows": 500000, "license": "CC-BY-NC-4.0", "summary": "500K participants with genome-wide genotyping, neuroimaging (~50K), biofluid biomarkers, and longitudinal clinical outcomes — primary cohort for late-onset disease genetics.", "version": "v2024", "file_format": "parquet", "download_url": "https://www.ukbiobank.ac.uk/enable-your-research/apply-for-access", "landing_page": "https://www.ukbiobank.ac.uk/" }, "content_hash": "sha256:4fd152f8353501e6a919a34662e416e5425fb1b99f3c96f5360ed6214e472ed6" }insert dataset ds-d47079e3a0cb 1h ago before / after
{ "title": "Answer ALS — Multi-omic Profiling of ALS Patients", "content": { "domain": "als", "n_rows": 1000, "license": "CC-BY-NC-4.0", "summary": "Multi-omic ALS patient profiling with iPSC-derived motor neurons, RNA-seq, ATAC-seq, proteomics, and clinical longitudinal data.", "version": "v2.0", "file_format": "h5ad", "download_url": "https://www.answerals.org/data", "landing_page": "https://www.answerals.org/" }, "content_hash": "sha256:18534d6fe2f57a2c1b6c9e626371f04c223ac303c9be6b50b6743bafc31484f4" }insert dataset ds-019c22e4197f 1h ago before / after
{ "title": "PPMI — Parkinson's Progression Markers Initiative", "content": { "domain": "parkinsons", "n_rows": 1500, "license": "CC-BY-4.0", "summary": "Longitudinal observational cohort of de novo Parkinson's patients with imaging, biofluids, genetics, clinical, and digital biomarkers.", "version": "v2024", "file_format": "csv", "download_url": "https://www.ppmi-info.org/access-data-specimens/download-data", "landing_page": "https://www.ppmi-info.org/" }, "content_hash": "sha256:35fadc17e86976c527ec8082a941b3bef5f3f12aa75b7fb842f5abad0f22f624" }insert dataset ds-c294f7512e2e 1h ago before / after
{ "title": "ADNI — Alzheimer's Disease Neuroimaging Initiative", "content": { "domain": "alzheimers", "n_rows": 2400, "license": "CC-BY-4.0", "summary": "Longitudinal multisite study with structural MRI, PET, CSF, plasma biomarkers, cognitive evaluations across cognitively-normal, MCI, and AD subjects.", "version": "v3", "file_format": "csv", "download_url": "https://adni.loni.usc.edu/data-samples/access-data/", "landing_page": "https://adni.loni.usc.edu/" }, "content_hash": "sha256:8a2436e2a3198ee8d088646ba609e6cfc358cf22d6baf3525e96844eaad26285" }insert clinical_trial ct-e68082258cfb 1h ago before / after
{ "title": "AMX0035 in ALS (CENTAUR / PHOENIX)", "content": { "phase": "phase_3", "domain": "als", "nct_id": "NCT05021536", "status": "completed", "sponsor": "Amylyx", "summary": "PHOENIX failed primary; Relyvrio voluntarily withdrawn April 2024. Triggered post-hoc reflection on Phase 2 effect-size inflation.", "metadata": {}, "indication": "ALS (no genetic stratification)", "n_enrolled": 664, "intervention": "AMX0035 (sodium phenylbutyrate + taurursodiol)", "primary_endpoint": "ALSFRS-R change at 48 weeks" }, "content_hash": "sha256:d746ef68e10f6147d8c3953c09837ab575c6b77d898cef1a208e733c76a9155c" }insert clinical_trial ct-8a19f66f271d 1h ago before / after
{ "title": "Inosine in Early Parkinson's Disease (SURE-PD3)", "content": { "phase": "phase_3", "domain": "parkinsons", "nct_id": "NCT02642393", "status": "completed", "sponsor": "NINDS / MJFF", "summary": "Failed primary endpoint despite Mendelian-randomization support for urate→PD; classic example of MR-justified target failing in trial.", "metadata": {}, "indication": "Early Parkinson's Disease", "n_enrolled": 298, "intervention": "Inosine to elevate serum urate", "primary_endpoint": "MDS-UPDRS Parts I-III change at 24 months" }, "content_hash": "sha256:b62d4b32691a3e6a23b57057d45f719df4802673b8d43b912ae34330365ef0da" }insert clinical_trial ct-a698fe12990c 1h ago before / after
{ "title": "Tominersen in Manifest Huntington's (GENERATION HD1)", "content": { "phase": "phase_3", "domain": "huntingtons", "nct_id": "NCT03761849", "status": "terminated", "sponsor": "Roche", "summary": "Halted March 2021 — exploratory analyses suggested potential harm from non-allele-specific HTT lowering. Reframed the field around earlier intervention + allele-selective targeting.", "metadata": {}, "indication": "Manifest Huntington's Disease", "n_enrolled": 791, "intervention": "Tominersen (antisense oligonucleotide targeting HTT)", "primary_endpoint": "cUHDRS at 101 weeks" }, "content_hash": "sha256:7d63a4884c0c619d2a86a1d0bb990a622541b12d273968e1d0485dadaa58eeea" }insert clinical_trial ct-c9090311c0fc 1h ago before / after
{ "title": "Pridopidine in Huntington's Disease (PROOF-HD)", "content": { "phase": "phase_3", "domain": "huntingtons", "nct_id": "NCT04556656", "status": "completed", "sponsor": "Prilenia Therapeutics", "summary": "Failed primary on cUHDRS; subgroup analyses suggested benefit in patients not on anti-dopaminergic background therapy.", "metadata": {}, "indication": "Manifest Huntington's Disease", "n_enrolled": 499, "intervention": "Pridopidine 45mg BID (sigma-1 receptor agonist)", "primary_endpoint": "cUHDRS at 65 weeks" }, "content_hash": "sha256:30c59a2d0d62cec4503e5333da77b216469a9128f39cad8fbade92ddbfb52f0e" }insert clinical_trial ct-cedf45c37d08 1h ago before / after
{ "title": "AAV-GBA1 Gene Therapy in Parkinson's (PR001)", "content": { "phase": "phase_2", "domain": "parkinsons", "nct_id": "NCT04127578", "status": "active", "sponsor": "Prevail Therapeutics / Lilly", "summary": "First systemic AAV gene therapy for a PD subtype; targets the most common genetic risk factor (GBA1 LoF).", "metadata": {}, "indication": "GBA1-mutant Parkinson's Disease", "n_enrolled": 78, "intervention": "PR001 (AAV9-GBA1 intracisternal)", "primary_endpoint": "Safety + GCase enzyme activity in CSF at 52 weeks" }, "content_hash": "sha256:ab2455231e8ab85275f0b047bad4fba938fe337df85ba153599f673c5c7187e8" }insert clinical_trial ct-aa9860aa02e1 1h ago before / after
{ "title": "Tofersen in SOD1 ALS (VALOR)", "content": { "phase": "phase_3", "domain": "als", "nct_id": "NCT02623699", "status": "completed", "sponsor": "Biogen", "summary": "Failed primary in VALOR; FDA accelerated approval April 2023 based on plasma neurofilament-light reduction. Surrogate-endpoint case study.", "metadata": {}, "indication": "SOD1-mutant ALS", "n_enrolled": 108, "intervention": "Tofersen (antisense oligonucleotide targeting SOD1)", "primary_endpoint": "ALSFRS-R change at week 28" }, "content_hash": "sha256:b82665b4c13f35ac1e459114e5f40eedf2aad85d80e291783b35212ee2b2203c" }insert clinical_trial ct-7eb5e2429601 1h ago before / after
{ "title": "Donanemab in Early Symptomatic Alzheimer's (TRAILBLAZER-ALZ 2)", "content": { "phase": "phase_3", "domain": "alzheimers", "nct_id": "NCT04437511", "status": "completed", "sponsor": "Eli Lilly", "summary": "35% slowing on iADRS in low/medium tau population; 2nd FDA-approved disease-modifier (Kisunla, July 2024).", "metadata": {}, "indication": "Early Symptomatic Alzheimer's Disease", "n_enrolled": 1736, "intervention": "Donanemab (anti-N3pG amyloid)", "primary_endpoint": "Integrated AD Rating Scale (iADRS) at 76 weeks" }, "content_hash": "sha256:5fb434859782aa2393923d827e1f5e83b9e28cb2a34616b505c813904b6fec7a" }insert clinical_trial ct-a69e36480c72 1h ago before / after
{ "title": "Lecanemab (BAN2401) in Early Alzheimer's Disease (Clarity AD)", "content": { "phase": "phase_3", "domain": "alzheimers", "nct_id": "NCT03887455", "status": "completed", "sponsor": "Eisai / Biogen", "summary": "Anti-amyloid monoclonal that achieved 27% slowing on CDR-SB; led to traditional FDA approval July 2023. Defined the post-amyloid AD-disease-modifying era.", "metadata": {}, "indication": "Early Alzheimer's Disease", "n_enrolled": 1795, "intervention": "Lecanemab (anti-amyloid monoclonal)", "primary_endpoint": "CDR-Sum of Boxes change from baseline at 18 months" }, "content_hash": "sha256:949ff3d915a7256c6aa69b98f98d719c3f114b1eecc81fa409f69d7b510c79ea" }insert dataset ds-af44621c91fa 1h ago before / after
{ "title": "ROSMAP — Religious Orders Study and Memory and Aging", "content": { "domain": "alzheimers", "n_rows": 3500, "license": "CC-BY-NC-4.0", "summary": "Two longitudinal cohorts of older adults with annual cognitive testing, brain donation, RNA-seq, proteomics, methylation, and detailed neuropath assessment.", "version": "v2024", "file_format": "csv", "download_url": "https://www.synapse.org/#!Synapse:syn3219045", "landing_page": "https://www.radc.rush.edu/" }, "content_hash": "sha256:0217583a7366c1601fc53a255e13658fa14db8a245c6bd6a1179b2f2bf1ac61d" }insert dataset ds-fdeaea52d20e 1h ago before / after
{ "title": "Tabula Sapiens — Human Single-Cell Atlas", "content": { "domain": "neuroscience", "n_rows": 1100000, "license": "CC-BY-4.0", "summary": "Cross-tissue single-cell transcriptomic atlas of healthy human donors — 1.1M cells, 24 organs, used as reference for cell-type deconvolution.", "version": "v2", "file_format": "h5ad", "download_url": "https://tabula-sapiens-portal.ds.czbiohub.org/", "landing_page": "https://tabula-sapiens-portal.ds.czbiohub.org/" }, "content_hash": "sha256:92073ae69617b6b303c6da7e5102ea2b2d4963c9336e9189b862351ddc364668" }insert dataset ds-e5ef08661f3f 1h ago before / after
{ "title": "DepMap 24Q4 — Cancer Cell Line Dependency Map", "content": { "domain": "neurodegeneration", "n_rows": 1100, "license": "CC-BY-4.0", "summary": "Genome-wide CRISPR knockouts (Chronos) across 1,100+ cancer cell lines plus drug sensitivity panels — foundational resource for target validation.", "version": "24Q4", "file_format": "csv", "download_url": "https://depmap.org/portal/data_page/", "landing_page": "https://depmap.org/" }, "content_hash": "sha256:bfd1426d8b74ae817ae6d48f1d2a6e5783a70653f9505b6772ae3d740afb5197" }insert dataset ds-803519b6aaeb 1h ago before / after
{ "title": "Allen Brain Atlas — Mouse Adult Brain ISH", "content": { "domain": "neuroscience", "n_rows": 26000, "license": "CC-BY-4.0", "summary": "In situ hybridization expression-energy maps for ~20K genes across mouse adult brain regions — the canonical brain-region-specific expression reference.", "version": "v2", "file_format": "csv", "download_url": "https://mouse.brain-map.org/", "landing_page": "https://atlas.brain-map.org/" }, "content_hash": "sha256:4b0c781d45c5cdc49dfbe44ba13d5f422b8b1521d8f745cf235b8c7ed213893d" }insert dataset ds-e010200ae110 1h ago before / after
{ "title": "GTEx v10 — Genotype-Tissue Expression", "content": { "domain": "neuroscience", "n_rows": 17382, "license": "CC-BY-4.0", "summary": "Bulk RNA-seq across 54 human tissues including 13 brain regions; eQTL maps used to instrument MR analyses.", "version": "v10", "file_format": "h5ad", "download_url": "https://gtexportal.org/home/downloads/adult-gtex/bulk_tissue_expression", "landing_page": "https://gtexportal.org/" }, "content_hash": "sha256:127b02d9e884390f38b7f9457704a2b18540316ae7d343f6ccd0226bf74af9a2" }insert dataset ds-1dd4d2c6eff0 1h ago before / after
{ "title": "DIAN — Dominantly Inherited Alzheimer Network", "content": { "domain": "alzheimers", "n_rows": 600, "license": "CC-BY-NC-4.0", "summary": "Autosomal-dominant AD families with longitudinal CSF, plasma, MRI, PET, and cognitive trajectories from pre-symptomatic through dementia stages.", "version": "v2024", "file_format": "csv", "download_url": "https://dian.wustl.edu/", "landing_page": "https://dian.wustl.edu/" }, "content_hash": "sha256:9876e82f334da885373a35ac3b5c759825554952ee51da49e2c1e4e75ad65317" }insert dataset ds-4e0c757cdcd8 1h ago before / after
{ "title": "UK Biobank — Population Cohort with Genomics + Imaging", "content": { "domain": "neurodegeneration", "n_rows": 500000, "license": "CC-BY-NC-4.0", "summary": "500K participants with genome-wide genotyping, neuroimaging (~50K), biofluid biomarkers, and longitudinal clinical outcomes — primary cohort for late-onset disease genetics.", "version": "v2024", "file_format": "parquet", "download_url": "https://www.ukbiobank.ac.uk/enable-your-research/apply-for-access", "landing_page": "https://www.ukbiobank.ac.uk/" }, "content_hash": "sha256:4fd152f8353501e6a919a34662e416e5425fb1b99f3c96f5360ed6214e472ed6" }insert dataset ds-db3f57bc515a 1h ago before / after
{ "title": "Answer ALS — Multi-omic Profiling of ALS Patients", "content": { "domain": "als", "n_rows": 1000, "license": "CC-BY-NC-4.0", "summary": "Multi-omic ALS patient profiling with iPSC-derived motor neurons, RNA-seq, ATAC-seq, proteomics, and clinical longitudinal data.", "version": "v2.0", "file_format": "h5ad", "download_url": "https://www.answerals.org/data", "landing_page": "https://www.answerals.org/" }, "content_hash": "sha256:18534d6fe2f57a2c1b6c9e626371f04c223ac303c9be6b50b6743bafc31484f4" }insert dataset ds-432967f32c2e 1h ago before / after
{ "title": "PPMI — Parkinson's Progression Markers Initiative", "content": { "domain": "parkinsons", "n_rows": 1500, "license": "CC-BY-4.0", "summary": "Longitudinal observational cohort of de novo Parkinson's patients with imaging, biofluids, genetics, clinical, and digital biomarkers.", "version": "v2024", "file_format": "csv", "download_url": "https://www.ppmi-info.org/access-data-specimens/download-data", "landing_page": "https://www.ppmi-info.org/" }, "content_hash": "sha256:35fadc17e86976c527ec8082a941b3bef5f3f12aa75b7fb842f5abad0f22f624" }insert dataset ds-7d0b9280c623 1h ago before / after
{ "title": "ADNI — Alzheimer's Disease Neuroimaging Initiative", "content": { "domain": "alzheimers", "n_rows": 2400, "license": "CC-BY-4.0", "summary": "Longitudinal multisite study with structural MRI, PET, CSF, plasma biomarkers, cognitive evaluations across cognitively-normal, MCI, and AD subjects.", "version": "v3", "file_format": "csv", "download_url": "https://adni.loni.usc.edu/data-samples/access-data/", "landing_page": "https://adni.loni.usc.edu/" }, "content_hash": "sha256:8a2436e2a3198ee8d088646ba609e6cfc358cf22d6baf3525e96844eaad26285" }insert dataset ds-a8a0f012a1bc 1h ago before / after
{ "title": "ADNI — Alzheimers Disease Neuroimaging Initiative", "content": { "domain": "alzheimers", "n_rows": 2400, "license": "CC-BY-4.0", "summary": "Longitudinal multisite study with structural MRI, PET, CSF, plasma biomarkers, cognitive evals across CN/MCI/AD.", "version": "v3", "n_columns": 85, "file_format": "csv", "download_url": "https://adni.loni.usc.edu/", "landing_page": "https://adni.loni.usc.edu/" }, "content_hash": "sha256:ee781ae5b1d45a418d09130a55ce55e519018e58d7346b20133d22b88535686b" }insert market_proposals prop-4e6f85614baa 1h ago before / after
{ "title": "Market: dispatch-integration", "content": { "status": "proposed", "rationale": "Funded knowledge gap auto-promoted to market.", "description": "Auto-promoted from funded knowledge_gap.\n\nOriginal gap: dispatch-integration\nDescription: x\n\nTriggered at funded_total=60.00 (threshold 50.00, 1 fund signals).", "entity_type": "knowledge_gap", "market_type": "gap_resolution", "proposer_id": "substrate", "proposer_type": "agent", "quorum_required": 3 }, "content_hash": "sha256:3c13e6bd2c61ac90063ed04d6ead8c6c6a686a0c6a1d1ca621b3ef4a86060210" }insert knowledge_gaps gap-c78a1ccd12f5 1h ago before / after
{ "title": "dispatch-integration", "content": { "domain": "test", "status": "open", "description": "x" }, "content_hash": "sha256:3a511f34025fbb26581fb387ec2e3bd89647d1ca087294f709882218fba44e34" }insert knowledge_gaps gap-a4ce440a8015 1h ago before / after
{ "title": "flag-disabled", "content": { "domain": "test", "status": "open", "description": "x" }, "content_hash": "sha256:5565a4382dcc380071078b5fd39207260eef93cf7714f4a9da3feb11ea1fa2cf" }insert market_proposals prop-a82c6d12730b 1h ago before / after
{ "title": "Market: already-promoted", "content": { "status": "proposed", "rationale": "Funded knowledge gap auto-promoted to market.", "description": "Auto-promoted from funded knowledge_gap.\n\nOriginal gap: already-promoted\nDescription: x\n\nTriggered at funded_total=60.00 (threshold 50.00, 1 fund signals).", "entity_type": "knowledge_gap", "market_type": "gap_resolution", "proposer_id": "substrate", "proposer_type": "agent", "quorum_required": 3 }, "content_hash": "sha256:64964cd1b8b4f55be88da3664974aadad7be109ce0c094b3b5e411423f785d48" }insert knowledge_gaps gap-cfaccfc9d56b 1h ago before / after
{ "title": "already-promoted", "content": { "domain": "test", "status": "open", "description": "x" }, "content_hash": "sha256:36ca7b4f02e552a2b18e4d88b204b40eede67987efb861a5523d79ec0704414c" }