• event 55m ago
  • event 20m ago
  • event 4d ago
  • event 1h ago
  • event 17h ago

Version history

1 version on record. Newest first; the live version sits at the top with a live indicator.

  1. Live
    4/4/2026, 5:16:58 AM
    Content snapshot
    {
      "sequence": "MEPLRGLLVLAGLAFWHLRGGWAPGALLLWSLGPSLGRAHSGPASCQLLACSLSTLAALCASCVLWVVSTALLFLLLLSLAALQLWQWGVAPSRQGPA",
      "target_protein": "Aβ oligomers",
      "score": 0.75,
      "method": "rosetta_interface_design",
      "metadata": {
        "method": "rosetta_interface_design",
        "sequence": "MEPLRGLLVLAGLAFWHLRGGWAPGALLLWSLGPSLGRAHSGPASCQLLACSLSTLAALCASCVLWVVSTALLFLLLLSLAALQLWQWGVAPSRQGPA",
        "mutations": [
          "T96S",
          "K186R",
          "A192V",
          "H157Y",
          "R62W"
        ],
        "uniprot_id": "Q9NZC2",
        "plddt_score": 0.87,
        "delta_G_kcal": -1.8,
        "rosetta_energy": -43.8,
        "binding_affinity": {
          "kd_nm": 120,
          "target": "Aβ oligomers"
        },
        "design_rationale": "Interface residue optimization for enhanced Aβ oligomer recognition. Slight stability trade-off accepted for 6.5x binding improvement.",
        "structure_pdb_url": null,
        "predicted_stability": 0.88,
        "binding_improvement_fold": 7.08
      }
    }