Search
30 results
-
Parkinson's disease individuals with normal cognition, 121 Parkinson's disease
matched in: search_vector
- Hypothesis Combination Gene Therapy Targeting RGS6 and Parkin or PINK1 to Address Mitochondrial Dysfunction
Parkinson's disease. **Mitochondrial Dysfunction in Parkinson's Disease** Mitochondrial
matched in: search_vector
-
Parkinson's disease patients. Moreover, nigral idiopathic Parkinson's disease
matched in: search_vector
-
Parkinson's disease can redirect a disease-relevant process. The original
matched in: search_vector
-
Parkinson's disease can redirect a disease-relevant process. The original
matched in: search_vector
-
Parkinson's disease (PD) inherits, but no longer obeys, the rate
matched in: search_vector
-
Parkinson's disease have increased the scope of biological knowledge
matched in: search_vector
-
Parkinson's Disease Causal-Mechanism DAG: α-Synuclein, Mitochondria, Lysosomes
matched in: search_vector
-
Parkinson's disease and addiction [Eisenstein2024, Stocchi2025]. Acetylcholine research has been
matched in: search_vector
-
Parkinson's disease, we performed a case-control study in two regions
matched in: search_vector
-
Parkinson's disease is characterized by the death of SNc dopaminergic
matched in: search_vector
-
First systemic AAV gene therapy for a PD subtype; targets the most common genetic risk factor (GBA1 LoF).
matched in: plain_text
-
Failed primary endpoint despite Mendelian-randomization support for urate→PD; classic example of MR-justified target failing in trial.
matched in: plain_text
-
MASGSCQGCEEDEETLKKLIVRLNNVQEGKQIETLVQILEDLLVFTFEK
matched in: plain_text
-
MKVISGEYALYAAEEPNTAVHQDIPDLRKQGAEVYITPLQQVRDLAKEY
matched in: plain_text
- Hypothesis Age-Accelerated miR-155 Upregulation Primes Nigral Microglia for Parkinson's Disease Pathology
Parkinson's Disease Pathology starts from the claim that modulating
matched in: search_vector
-
Parkinson's Disease Models starts from the claim that modulating
matched in: search_vector
-
Parkinson's disease and related movement disorders. **Molecular Mechanism and Rationale
matched in: search_vector
- Paper The proliferative capacity of the subventricular zone is maintained in the parkinsonian brain.
Parkinson's disease, which might be due to a lack
matched in: search_vector
-
Parkinson's disease diagnosis, and on stable doses of Parkinson
matched in: search_vector
-
Parkinson's disease. Around 30% of patients with Parkinson's disease
matched in: search_vector
-
Parkinson's disease has remained controversial and elusive. The protein
matched in: search_vector
- Hypothesis TFEB Activation to Restore Lysosomal Function in Parkinson's Disease Alpha-Synuclein Clearance
Parkinson's disease is characterized by the accumulation of misfolded
matched in: search_vector
-
Parkinson's disease. They exhibit incomplete penetrance. The objective of the present
matched in: search_vector
-
Parkinson's disease. We compared this treatment plus medication with
matched in: search_vector
-
Parkinson's disease (PD) is a neurodegenerative disorder characterized, in part
matched in: search_vector
-
Parkinson's disease symptoms - Applying genetic, electrophysiological, and optical tools
matched in: search_vector
-
Parkinson's disease, the baseline neuron counts from which degeneration
matched in: search_vector
-
Parkinson's disease is a debilitating neurological disorder that affects
matched in: search_vector
-
parkinsonism could be induced by a toxin inhibiting mitochondrial respiratory
matched in: search_vector